DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and CG9676

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:248 Identity:64/248 - (25%)
Similarity:98/248 - (39%) Gaps:47/248 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 GEFPWMVGIFTGRQEFLCGGTLIHPRLVVTTSHNL--------VNETVDTLVARAGDWDLNSLNE 253
            |:||..:.: ..|....|||::|....|||.:|.:        .||    |..:||...|:|...
  Fly    37 GQFPHQISL-RRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANE----LEIQAGSLLLSSGGV 96

  Fly   254 PYPHQGSRIKEIIMHSEFDPNSLYNDIALLLLDEPIRLAPHIQPLCLPPPESPELTNQLLSVTCY 318
            ..|     :..:.:|..::.|.  :|:|:|.|...:....:|..:.|...:.|.      ..|..
  Fly    97 RVP-----VATVTVHPNYNSNG--HDVAVLRLRNSLTFNSNIAAIKLATEDPPN------DATVD 148

  Fly   319 ATGWGT-KEAGSDKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRPSFICAGGDPGKDTCKG 382
            .:|||. .:.|  .:.:.|..:.:..:.||.||    .|.|.   :|..:.:|......|..|.|
  Fly   149 ISGWGAISQRG--PISNSLLYVQVKALSRESCQ----KTYLR---QLPETTMCLLHPKDKGACYG 204

  Fly   383 DGGSPLFCQMPGEMDRYQ--LVGIVSWGVECAVEDIPAVYVNVPHLRGWIDEK 433
            |.|.|.         .||  |||:.|:.:.......|..|..|..||.||.||
  Fly   205 DSGGPA---------TYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAEK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 62/246 (25%)
Tryp_SPc 197..430 CDD:214473 60/243 (25%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 60/243 (25%)
Tryp_SPc 28..248 CDD:238113 62/246 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457447
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.