DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and CG31827

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_723923.1 Gene:CG31827 / 318965 FlyBaseID:FBgn0051827 Length:294 Species:Drosophila melanogaster


Alignment Length:264 Identity:94/264 - (35%)
Similarity:144/264 - (54%) Gaps:9/264 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 CGYSNPKGLIPDNDKFPYSEDVSIFGEFPWMVGIFTGRQEFLCGGTLIHPRLVVTTSHNLVNETV 236
            |||.||..:   ..:|..:|..:...||||.:.:...| ..:.||:||.|.:|:|.:|.:.|:.|
  Fly    31 CGYGNPDAV---KVQFNVTEGQAKPAEFPWTIAVIHNR-SLVGGGSLITPDIVLTAAHRIFNKDV 91

  Fly   237 DTLVARAGDWDLNSLNEPYPHQGSRIKEIIMHSEFDPNSLYNDIALLLLDEPIRLAPHIQPLCLP 301
            :.:|..||:|:..|..|.||.:.:.:.::::|..|:.....|::|||.||....|...|..:|||
  Fly    92 EDIVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINTICLP 156

  Fly   302 PPESPELTNQLLSVTCYATGWGTKEAGSDKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRP 366
            ..:     ..|.|..|...|||..:........|||:|:||:|.|..||.:||.|||...:.|..
  Fly   157 TQK-----RSLSSTRCIVAGWGKYQFSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLPR 216

  Fly   367 SFICAGGDPGKDTCKGDGGSPLFCQMPGEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRGWID 431
            ..|||||:...|.|.||||..|||.|..:..:::.:|||:|||.|..:::||.|.:|...:.||.
  Fly   217 GLICAGGEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWIV 281

  Fly   432 EKIR 435
            ::|:
  Fly   282 QQIK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 86/235 (37%)
Tryp_SPc 197..430 CDD:214473 84/232 (36%)
CG31827NP_723923.1 Tryp_SPc 50..283 CDD:238113 86/238 (36%)
Tryp_SPc 50..280 CDD:214473 84/235 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457412
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.