DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and CG33127

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster


Alignment Length:259 Identity:68/259 - (26%)
Similarity:112/259 - (43%) Gaps:43/259 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 DVSIFGEFPWMVGIFTGRQEF--LCGGTLIHPRLVVTTSHNLVNETVDTLVARAGDWDLNSLNEP 254
            ||......|::|.:...|..:  |||.::|..|.::|.:|     .||.|....||    ::..|
  Fly    46 DVQGVDNVPYLVSLSLTRATYTHLCGASIIGKRWLLTAAH-----CVDELRTFNGD----AVGTP 101

  Fly   255 YPHQG---------SRIKEI---IMHSEFDPNSLYNDIALLLLDEPIRLAPHIQPLCLPPPESPE 307
            . :.|         ::::.:   ..|..|:.|:..::||||.:.|.......:|.:.|     |:
  Fly   102 V-YAGIINRSNVTAAQVRYVDFASTHRSFNGNAGSDNIALLHVSESFEYNARVQQIAL-----PD 160

  Fly   308 LTNQLLSVTCYATGWGTKEAGSDKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRPSFICAG 372
            :.:...:.|..|.|||..:...|:....|:....||:....|:     ..|.|...|....:|: 
  Fly   161 INDDYSNKTAAAYGWGLTDPDGDEYSKELQYAFAPLLNSTGCK-----ELLPADAPLTAQQVCS- 219

  Fly   373 GDPGKDTCKGDGGSPL-FCQMPGEMDRYQLVGIVSWG-VECAVEDIPAVYVNVPHLRGWIDEKI 434
               ...||.||||:|| :..:.|..   :|||:.||. :.|...:.|.||.:||...|||.:.|
  Fly   220 ---QVKTCYGDGGTPLIYWPITGPA---ELVGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQTI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 65/251 (26%)
Tryp_SPc 197..430 CDD:214473 63/248 (25%)
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 67/256 (26%)
Tryp_SPc 41..273 CDD:214473 65/253 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.