DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and CG32523

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:253 Identity:70/253 - (27%)
Similarity:100/253 - (39%) Gaps:55/253 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 GEFPWMVGIFTGRQEFLCGGTLIHPRLVVTTSHNLV--NETV--DTLVARAGDWDLNSLNEPYPH 257
            |:||..:.:.. |.|..|||.:|....|:|..|.:.  |:.|  |....:||...|:|       
  Fly    46 GQFPHQISLRL-RGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSS------- 102

  Fly   258 QGSRI--KEIIMHSEFDPNSLYNDIALLLLDEPIRLAPHIQPLCLPPPESPELTNQLLSVTCYA- 319
            .|.||  .|:|||..:.... :||:|:|.|..|:....:|..:.|...:.|         .|.| 
  Fly   103 DGVRIPVAEVIMHPNYATGG-HNDLAVLRLQSPLTFDANIAAIQLATEDPP---------NCVAV 157

  Fly   320 --TGWGT-KEAG--SDKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRPSFICAGGDPGKDT 379
              :|||. .|.|  ||.|..|    .:..:.|..|:....:       ||..:.||.........
  Fly   158 DISGWGNIAEKGPLSDSLLFV----QVTSISRGACRWMFYS-------RLPETMICLLHSKNSGA 211

  Fly   380 CKGDGGSPLFCQMPGEMDRY--QLVGIVS--WGVECAVEDIPAVYVNVPHLRGWIDEK 433
            |.||.|.|.         .|  ::||:.|  .|..|. ...|..|:.:..:|.||.||
  Fly   212 CYGDSGGPA---------TYGGKVVGLASLLLGGGCG-RAAPDGYLRISKVRAWIAEK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 68/251 (27%)
Tryp_SPc 197..430 CDD:214473 66/248 (27%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 66/248 (27%)
Tryp_SPc 37..219 CDD:238113 56/201 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457449
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.