DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and CG32376

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:304 Identity:68/304 - (22%)
Similarity:130/304 - (42%) Gaps:65/304 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 NPRISPIQCSKSLYRCCAVDQKVDDSESPYLVKQANFKYKNCGYSNPKGLIPDNDKFPYSEDVSI 195
            ||.|:.::..:|........:::..:|:|:   |.:..|:  ||                     
  Fly    50 NPFINALEAQESFPTRIVNGKRIPCTEAPF---QGSLHYE--GY--------------------- 88

  Fly   196 FGEFPWMVGIFTGRQEFLCGGTLIHPRLVVTTSHNLVNETVDTLVARAGDWDLNSLNEPYPHQGS 260
                            |:||..:|: ::.:.|:|:......:....|.|     |..:....|..
  Fly    89 ----------------FVCGCVIIN-KIWILTAHHCFFGPPEKYTVRVG-----SDQQRRGGQLR 131

  Fly   261 RIKEIIMHSEFDPNSLYNDIALLLLDEPIRLAPHIQPLCLPPPESPELTNQLLSVTCYATGWGTK 325
            .:|:|:..:.::..::.:|:|::.|..|:.....::|:.||..::.:...:.:     .:|||..
  Fly   132 HVKKIVALAAYNDYTMRHDLAMMKLKSPVYFGKCVRPVKLPSTKTTKFPKKFV-----VSGWGIT 191

  Fly   326 EAGSDKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRPSFICAGGDPGKDTCKGDGGSPLFC 390
            .|.:..::..|:|:.:..::|.:||...:    :|..::....||| ....||:|.||.|.||  
  Fly   192 SANAQNVQRYLRRVQIDYIKRSKCQKMYK----KAGLKIYKDMICA-SRTNKDSCSGDSGGPL-- 249

  Fly   391 QMPGEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRGWIDEKI 434
                 ..|..|.||||||:.||.::.|.||||......||.:.|
  Fly   250 -----TSRGVLYGIVSWGIGCANKNYPGVYVNCKRYVPWIKKVI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 57/235 (24%)
Tryp_SPc 197..430 CDD:214473 55/232 (24%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 61/283 (22%)
Tryp_SPc 66..287 CDD:238113 63/285 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457477
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.