DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and Prss32

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001100453.1 Gene:Prss32 / 302970 RGDID:1311905 Length:334 Species:Rattus norvegicus


Alignment Length:284 Identity:83/284 - (29%)
Similarity:121/284 - (42%) Gaps:61/284 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 CGYSNPKGLIPDNDKFPYSEDVSIFGEFPWMVGIFTGRQE--FLCGGTLIHPRLVVTTSH----- 229
            ||.....|.|       .|...:..|::||.|.:   |::  .:|||:||....|:|.:|     
  Rat    45 CGRPRASGRI-------VSGQNAQLGQWPWQVSV---REDGVHVCGGSLISEDWVLTAAHCFNQD 99

  Fly   230 -NLVNETV--DTLVARAGDWDLNSLNEP-----------YPHQGSRIKEIIMHSEFDPNSLYNDI 280
             :|...||  .|:.:...|      |||           ||...:.     .||.       .||
  Rat   100 QHLSAYTVLLGTISSYPED------NEPRELRAVAQYIKYPSYSAE-----EHSS-------GDI 146

  Fly   281 ALLLLDEPIRLAPHIQPLCLPPPESPELTNQLLSVTCYATGWGTKEAGSDKL--EHVLKRINLPL 343
            |||.|..||....::.|:|||.|..|.....:    |:.|||| ..|.:..|  ...|:.:.:||
  Rat   147 ALLQLASPISFNDYMLPVCLPKPGDPLDPGTM----CWVTGWG-NIATNQPLPPPFTLQELQVPL 206

  Fly   344 VEREECQAKLRNTRLEARFR-LRPSFICAGGDPG-KDTCKGDGGSPLFCQMPGEMDRYQLVGIVS 406
            ::.:.|....:...:.:..: :....:|||...| ||.|.||.|.||.|.:   .|.:...|:||
  Rat   207 IDAKTCNTYYQENSVPSTEQVILEDMLCAGFVEGKKDACNGDSGGPLVCDV---NDVWIQAGVVS 268

  Fly   407 WGVECAVEDIPAVYVNVPHLRGWI 430
            ||.:||:.:.|.||.||.....||
  Rat   269 WGSDCALSNRPGVYTNVSVYISWI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 78/259 (30%)
Tryp_SPc 197..430 CDD:214473 76/257 (30%)
Prss32NP_001100453.1 Tryp_SPc 53..292 CDD:214473 78/274 (28%)
Tryp_SPc 54..295 CDD:238113 80/275 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 162 1.000 Domainoid score I3893
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8953
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.