DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and Prss34

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:275 Identity:83/275 - (30%)
Similarity:129/275 - (46%) Gaps:45/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 LIPDNDKFPYSEDVSIFG-------EFPWMVGI-----FTGRQEFLCGGTLIHPRLVVTTSHNLV 232
            |.||:.:    |.|.|.|       .|||.|.:     ...:.|.:|||:||||:.|:|.:|.:.
  Rat    22 LTPDSGQ----ELVGIVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIHPQWVLTAAHCVE 82

  Fly   233 NETVDTLVARAGDWDLNSLNEPYPHQGSRIKEIIMHSEFD-----PNSLYNDIALLLLDEPIRLA 292
            .:.::....|.   .:..|......|..::.:||.|.:|.     |...  |||||.||..:.|:
  Rat    83 LKEMEASCFRV---QVGQLRLYENDQLMKVAKIIRHPKFSEKLSAPGGA--DIALLKLDSTVVLS 142

  Fly   293 PHIQPLCLPPPESPELTNQLLS--VTCYATGWGTKEAGSDKLE---HVLKRINLPLVEREECQAK 352
            ..:.|:.||      ..:|.:|  .|.:..|||..| |...|.   | |:.:.:|:|...:|:.|
  Rat   143 ERVHPVSLP------AASQRISSKKTWWVAGWGVIE-GHRPLPPPCH-LREVAVPIVGNSDCEQK 199

  Fly   353 LRN-TRLEARFR-LRPSFICAGGDPGKDTCKGDGGSPLFCQMPGEMDRYQLVGIVSWGVECAVED 415
            .|. :.|:...: ::...:|||.: |:|:|:.|.|.||.|:....   :..||:||||:.|.:.|
  Rat   200 YRTYSSLDRTTKIIKDDMLCAGME-GRDSCQADSGGPLVCRWNCS---WVQVGVVSWGIGCGLPD 260

  Fly   416 IPAVYVNVPHLRGWI 430
            .|.||..|.....||
  Rat   261 FPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 77/258 (30%)
Tryp_SPc 197..430 CDD:214473 75/256 (29%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 78/260 (30%)
Tryp_SPc 33..275 CDD:214473 76/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8953
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.