DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and Prss29

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:248 Identity:82/248 - (33%)
Similarity:131/248 - (52%) Gaps:30/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 GEFPWMVGIFTGRQEF-----LCGGTLIHPRLVVTTSHNLVNETVDTLVARAGDWDLNSLNEPYP 256
            |::||.|.:...|..:     :|||::|||:.|:|.:|.:.....|....|.      .|.:.|.
  Rat    40 GKWPWQVSLRVYRYNWASWVHICGGSIIHPQWVLTAAHCIHESDADPSAFRI------YLGQVYL 98

  Fly   257 HQGS---RIKEIIMHSEFDPNSLYNDIALLLLDEPIRLAPHIQPLCLPPPESPELTNQLLSVTCY 318
            :.|.   ::..:|:|.:|..:.|.:|:|||.|.:.:|..|:::|:.| .|.|.|:|.:   ..|:
  Rat    99 YGGEKLLKVSRVIIHPDFVRSGLGSDVALLQLAQSVRSFPNVKPVKL-SPASLEVTKK---DVCW 159

  Fly   319 ATGWGTKEAGSDKL--EHVLKRINLPLVEREECQAKLRN-TRLE---ARFRLRPSFICAGGDPGK 377
            .||||:... .:.|  .:.|:::.:.:|:...|:...|| |||.   .|..|: ..:|||.. |:
  Rat   160 VTGWGSVSM-HESLPPPYRLQQVQVKIVDNTLCEKLYRNATRLSNHGQRLILQ-DMLCAGSH-GR 221

  Fly   378 DTCKGDGGSPLFCQMPGEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRGWI 430
            |:|.||.|.||.|.:.|.   :.|||:||||..||::|||.||..|.....||
  Rat   222 DSCYGDSGGPLVCNVTGS---WTLVGVVSWGYGCALKDIPGVYARVQFFLPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 82/248 (33%)
Tryp_SPc 197..430 CDD:214473 80/246 (33%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346333
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.