DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and CG33225

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:274 Identity:79/274 - (28%)
Similarity:126/274 - (45%) Gaps:42/274 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 NCGY----SNPKGLIPDNDKFPYSEDVSIFGEFPWMVGIFTGRQEFLCGGTLIHPRLVVTTSHNL 231
            :||.    |..:.::..||...::.        ||||.:. |.....|.|:||....|:|::..|
  Fly    44 DCGTTRHPSRIRRVVGGNDADRFAN--------PWMVMVL-GENNVFCSGSLITRLFVLTSASCL 99

  Fly   232 VNETVDTLVARAGDWDLN--SLNEPYPHQGSRIKEIIMHSEFDPNSLYN-DIALLLLDEPIRLAP 293
            ::.....::   |::|.|  |.:.....|...|.:.|:|.:|...::.. |||||.|.:.:.::.
  Fly   100 LSLPKQVIL---GEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETVKKYDIALLRLAKKVSISD 161

  Fly   294 HIQPLCLPPPESPELTNQLLSVTCYATGWGTKEAGSDKLEHVLKRINLPLVEREECQAKLRNTRL 358
            :::|:||........:.|..:    ||||||.|......  :|:.:.|..:.|:.|:.:||.   
  Fly   162 YVRPICLSVDRQVGRSVQHFT----ATGWGTTEWNEPST--ILQTVTLSKINRKYCKGRLRQ--- 217

  Fly   359 EARFRLRPSFICAGGDPGKDTCKGDGGSPLFCQMPGEMD-------RYQLVGIVSWGVECAVEDI 416
                .:..|.:|.|| |.||||.||.|.||...:..:.|       |..|:||||:| ..:...|
  Fly   218 ----NIDASQLCVGG-PRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYG-SSSCSGI 276

  Fly   417 PAVYVNVPHLRGWI 430
             .||.||.|...||
  Fly   277 -GVYTNVEHYMDWI 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 74/244 (30%)
Tryp_SPc 197..430 CDD:214473 72/242 (30%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 74/260 (28%)
Tryp_SPc 57..292 CDD:238113 76/261 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.