DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and Prss43

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_955765.1 Gene:Prss43 / 272643 MGIID:2684822 Length:382 Species:Mus musculus


Alignment Length:357 Identity:97/357 - (27%)
Similarity:156/357 - (43%) Gaps:78/357 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 ISLINPRIS----PIQCSKSLYRCCAVDQKVDDSESPYLVKQANFKYKNCGYSNPKGLIP---DN 184
            :.|:.|..|    |.:.|..::|.....:...|.|:|  .:|:  :.|:...|:|.| :|   |.
Mouse    19 LQLLQPLFSGTYKPREDSGVMHRPQRPRRPRSDPEAP--AQQS--RLKSLSISHPSG-VPVSVDR 78

  Fly   185 DKFPYS--------------EDVSIFGEF-----------------------PWMVGIFTGRQEF 212
            .:.|.|              ...|:.|.|                       ||.|.: ..:.|.
Mouse    79 TEIPGSGSPSGTTTKITLENRRSSLGGPFFTDTCGHRITEVDPGSLSAGRKWPWQVSL-QSQNEH 142

  Fly   213 LCGGTLIHPRLVVTTSHNLVNETVDTLVARAGDWDLNSLNEP---YPHQGSRIKEIIMHSEFDPN 274
            :|||:||..|.|:|.:|.:..:  :..:...||..|:|.:|.   .|     :::||..|.||..
Mouse   143 VCGGSLISHRWVLTAAHCIYEQ--EEYMVMLGDDMLHSESESVTLVP-----VQDIIFPSNFDIQ 200

  Fly   275 SLYNDIALLLLDEPIRLAPHIQPLCLPPPESP-ELTNQLLSVTCYATGWGTK---EAG--SDKLE 333
            ::.|||||.||..|:..:..|||:||  ||.| .:.|   ...|:.||||.:   :||  |..|:
Mouse   201 TMRNDIALALLYFPVNYSSLIQPVCL--PEEPFRVKN---GTVCWVTGWGQQNEIDAGFASILLQ 260

  Fly   334 HVLKRINLPLVEREECQAKLRNTRLEARFRLRPSFICAGGDPGKDTCKGDGGSPLFCQMPGEMDR 398
            .|.:||.|    ::.|....:.....::..:....||...|.|:..|.||.|:||.|:..   :.
Mouse   261 EVQQRILL----QKHCNTLFQRQLGTSKNLVIKGMICGLQDSGQSLCWGDSGNPLVCESD---NT 318

  Fly   399 YQLVGIVSWGVECAVEDIPAVYVNVPHLRGWI 430
            :..|||:|||:.|....:.:||.::.....|:
Mouse   319 WTQVGIMSWGINCNGVPVLSVYTDIAEYNEWV 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 78/266 (29%)
Tryp_SPc 197..430 CDD:214473 77/264 (29%)
Prss43NP_955765.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..97 15/71 (21%)
Tryp_SPc 117..351 CDD:238113 76/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.