DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and Tpsg1

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:255 Identity:81/255 - (31%)
Similarity:114/255 - (44%) Gaps:41/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 GEFPWMVGIFTGRQEFLCGGTLIHPRLVVTTSH---NLVNETVDTLVARAGDWD--LNSLNEPYP 256
            |.:||...:.. .:..:|||:|:.|..|:|.:|   ..||         :.|:.  |..|.....
Mouse    96 GTWPWQASLRL-HKVHVCGGSLLSPEWVLTAAHCFSGSVN---------SSDYQVHLGELTVTLS 150

  Fly   257 HQGSRIKEIIMH--SEFDPNSLYNDIALLLLDEPIRLAPHIQPLCLPPPES---PELTNQLLSVT 316
            ...|.:|.|||:  |...|.| ..||||:.|..|:.|:..:||:|||...:   |       .:.
Mouse   151 PHFSTVKRIIMYTGSPGPPGS-SGDIALVQLSSPVALSSQVQPVCLPEASADFYP-------GMQ 207

  Fly   317 CYATGWG-TKEAGSDKLEHVLKRINLPLVEREECQAKLR--NTRLEARFRLRPSFICAGGDPGKD 378
            |:.|||| |.|....|..:.|:...:.:|:.:.|.....  |..|     ::|..:||.| || |
Mouse   208 CWVTGWGYTGEGEPLKPPYNLQEAKVSVVDVKTCSQAYNSPNGSL-----IQPDMLCARG-PG-D 265

  Fly   379 TCKGDGGSPLFCQMPGEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRGWIDEKIRGLG 438
            .|:.|.|.||.||:.|   .:|..|:||||..|...|.|.||..|.....||...|...|
Mouse   266 ACQDDSGGPLVCQVAG---TWQQAGVVSWGEGCGRPDRPGVYARVTAYVNWIHHHIPEAG 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 79/248 (32%)
Tryp_SPc 197..430 CDD:214473 77/245 (31%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 79/248 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842849
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.