DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and Prss45

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_694812.1 Gene:Prss45 / 260408 MGIID:3605764 Length:317 Species:Mus musculus


Alignment Length:282 Identity:73/282 - (25%)
Similarity:121/282 - (42%) Gaps:46/282 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 LIPDNDKFPYSEDVS--IFG------------EFPWMVGIFTGRQEFLCGGTLIHPRLVVTTSHN 230
            |:|......|:|:.:  :.|            .:||...:.. ..:.:|||.||....||:.:|.
Mouse    28 LLPPRPNLGYNENYTEPVCGTPWWPDNLEESHHWPWEASLQI-EDKHVCGGALIDRSWVVSAAHC 91

  Fly   231 L-------VNETVDTLVARAGDWDLNSLNEPYPHQGSRIKEIIMHSEF-DPNSLYNDIALLLLDE 287
            :       |.....||......|.|.     .|     :.:||:|.:: ..|.:.:|||||.|:.
Mouse    92 IQGNKEYSVMLGSSTLHPNGSSWTLK-----IP-----VGDIIIHPKYWGRNFIRSDIALLCLET 146

  Fly   288 PIRLAPHIQPLCLPPPESPELTNQLLSVTCYATGWG-TKEAGSDKLEHV--LKRINLPLVEREEC 349
            |:....::||:|||...    .|..:...|:.|||| .|:..|.:|...  |....:.:::.:.|
Mouse   147 PVTFNKYVQPICLPEHN----FNFKVGTKCWVTGWGQVKQHSSAQLTPAPELWEAEVFIIDNKNC 207

  Fly   350 QAKLRNTRLEARF--RLRPSFICAGGDPGKDTCKGDGGSPLFCQMPGEMDRYQLVGIVSWGVECA 412
            .:......|..:.  .:|.:.||. .:.|:|.|.||.|.||.|::.|   |:.|.|:.||...||
Mouse   208 DSIFHKKTLYPQVVPLIRKNMICT-TNYGEDLCYGDPGGPLACEIDG---RWILAGVFSWEKACA 268

  Fly   413 VEDIPAVYVNVPHLRGWIDEKI 434
            .....:||..:.....||.:::
Mouse   269 TVPNLSVYTRITKYTIWIKDQV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 69/260 (27%)
Tryp_SPc 197..430 CDD:214473 67/257 (26%)
Prss45NP_694812.1 Tryp_SPc 59..289 CDD:238113 68/248 (27%)
Tryp_SPc 59..286 CDD:214473 66/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.