DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and TPSG1

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:257 Identity:79/257 - (30%)
Similarity:118/257 - (45%) Gaps:45/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 GEFPWMVGIFTGRQEFLCGGTLIHPRLVVTTSHNLVNETVDTLVARAGDWDLNSLNEPYPHQG-- 259
            |.:||...:.. |:..:|||:|:.|:.|:|.:|             .....||| ::...|.|  
Human    72 GAWPWQASLRL-RRVHVCGGSLLSPQWVLTAAH-------------CFSGSLNS-SDYQVHLGEL 121

  Fly   260 --------SRIKEIIMHSEFDPN---SLYNDIALLLLDEPIRLAPHIQPLCLPPPESPELTNQLL 313
                    |.:::||:||  .|:   ....||||:.|..|:.|:..|.|:||     ||.::...
Human   122 EITLSPHFSTVRQIILHS--SPSGQPGTSGDIALVELSVPVTLSSRILPVCL-----PEASDDFC 179

  Fly   314 -SVTCYATGWG-TKEAGSDKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRPSFICAGGDPG 376
             .:.|:.|||| |:|.......:.|:.:.:.:|:.|.|:   |:........|:|..:||.| ||
Human   180 PGIRCWVTGWGYTREGEPLPPPYSLREVKVSVVDTETCR---RDYPGPGGSILQPDMLCARG-PG 240

  Fly   377 KDTCKGDGGSPLFCQMPGEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRGWIDEKIRGLG 438
             |.|:.|.|.||.||:.|   .:...|.||||..|...:.|.||..||....||...|...|
Human   241 -DACQDDSGGPLVCQVNG---AWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWIRRHITASG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 77/250 (31%)
Tryp_SPc 197..430 CDD:214473 75/247 (30%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 75/247 (30%)
Tryp_SPc 63..293 CDD:238113 77/250 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152794
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.