DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and CG30088

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:316 Identity:91/316 - (28%)
Similarity:131/316 - (41%) Gaps:75/316 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 SKSLYRCCAVDQKVDDSESPYLVKQ----ANFKYKNCGYSNPKGLIPDNDKFPYSEDV------- 193
            |.|:|.|..|          .||.|    |||...:||.|             |..:|       
  Fly     7 STSIYICMCV----------CLVLQEQVAANFLIPSCGVS-------------YESNVATRIVRG 48

  Fly   194 --SIFGEFPWMVGIFTGRQEFLCGGTLIHPRLVVTTSHNLVNETVDTLVARAGDWDLNSLNEPYP 256
              ::....|:|..::.. .|..||||:|..|.::|.:|.:    ...|..|.|:.|:.  ..|..
  Fly    49 KEAMLKSAPFMAYLYYS-SEIHCGGTIISSRYILTAAHCM----RPYLKVRLGEHDIT--RNPDC 106

  Fly   257 HQGS-----RIKEIIM---HSEFDPNSLYNDIALLLLDEPIRLAPHIQPLC--LPPPESPELTNQ 311
            ..||     ...:|::   :..|| ..|.||||||.|...||...||||:|  |.|..:|.:.. 
  Fly   107 QGGSCSPPAEEFDIVLATKYKRFD-RFLANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHE- 169

  Fly   312 LLSVTCYATGWGTKEAGSDKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRPSFICAGGDPG 376
                 ..|.|||..|  ::...:||:...|...:...|::.|       ...:..:.:|.|.. |
  Fly   170 -----FQAFGWGQTE--TNHSANVLQTTVLTRYDNRHCRSVL-------SMPITINQLCVGFQ-G 219

  Fly   377 KDTCKGDGGSPLFCQMPGE-MDRYQLVGIVSWGVE-CAVEDIPAVYVNVPHLRGWI 430
            .|||.||.|.||..::..: :.||..:||||:|.: |   ..|.||..||:...||
  Fly   220 SDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKC---QSPGVYTYVPNYIRWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 75/246 (30%)
Tryp_SPc 197..430 CDD:214473 73/244 (30%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 73/254 (29%)
Tryp_SPc 45..273 CDD:238113 75/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.