DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and TPSD1

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:223 Identity:69/223 - (30%)
Similarity:104/223 - (46%) Gaps:43/223 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 KFPYSEDVSIFGEFPWMVGIFTGRQEFLCGGTLIHPRLVVTTSHNLVNETVDTLVARAGDWDLNS 250
            |:|:...:.:.|.: ||         ..|||:||||:.|:|.:|.:..:..|....|.   .|..
Human    48 KWPWQVSLRVRGPY-WM---------HFCGGSLIHPQWVLTAAHCVEPDIKDLAALRV---QLRE 99

  Fly   251 LNEPYPHQGSRIKEIIMHSEFDPNSLYNDIALLLLDEPIRLAPHIQPLCLP------PPESPELT 309
            .:..|..|...:..||:|.:|.......|||||.|:||:.::.||..:.||      ||..|   
Human   100 QHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSHIHTVTLPPASETFPPGMP--- 161

  Fly   310 NQLLSVTCYATGWGTKEAGSDKLEHV-----LKRINLPLVEREECQAKLRNTRLEA--RFRL-RP 366
                   |:.||||    ..|...|:     ||.:.:|:||...|.|:. :|.|..  .|:: |.
Human   162 -------CWVTGWG----DVDNNVHLPPPYPLKEVEVPVVENHLCNAEY-HTGLHTGHSFQIVRD 214

  Fly   367 SFICAGGDPGKDTCKGDGGSPLFCQMPG 394
            ..:|||.: ..|:|:||.|.||.|::.|
Human   215 DMLCAGSE-NHDSCQGDSGGPLVCKVNG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 67/212 (32%)
Tryp_SPc 197..430 CDD:214473 67/212 (32%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 69/223 (31%)
Tryp_SPc 38..240 CDD:214473 68/220 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152803
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.