DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and Tpsb2

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:277 Identity:80/277 - (28%)
Similarity:131/277 - (47%) Gaps:48/277 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 YSNPKGLIPDNDKFPYSEDVSIFG-------EFPWMVGIFTGRQEFL--CGGTLIHPRLVVTTSH 229
            ||.|:         |.::.|.|.|       ::||.|.:......::  |||:||||:.|:|.:|
Mouse    20 YSAPR---------PANQRVGIVGGHEASESKWPWQVSLRFKLNYWIHFCGGSLIHPQWVLTAAH 75

  Fly   230 NLVNETVDTLVARAGDWDLNSLNEPYPHQGSR---IKEIIMHSEFDPNSLYNDIALLLLDEPIRL 291
            .:........:.|.      .|.|.|.:.|.:   :..|::|..:.......|:|||.|:.|:.:
Mouse    76 CVGPHIKSPQLFRV------QLREQYLYYGDQLLSLNRIVVHPHYYTAEGGADVALLELEVPVNV 134

  Fly   292 APHIQPLCLPPPES--PELTNQLLSVTCYATGWGTKEAGSDK---LEHVLKRINLPLVEREECQA 351
            :.|:.|:.|||...  |..|      :|:.||||  :..:|:   ..:.||::.:|:||...|..
Mouse   135 STHLHPISLPPASETFPPGT------SCWVTGWG--DIDNDEPLPPPYPLKQVKVPIVENSLCDR 191

  Fly   352 KLRNTRLEA--RFRL-RPSFICAGGDPGKDTCKGDGGSPLFCQMPGEMDRYQLVGIVSWGVECAV 413
            |. :|.|..  .|.: ....:|| |:..:|:|:||.|.||.|::.|   .:...|:||||..||.
Mouse   192 KY-HTGLYTGDDFPIVHDGMLCA-GNTRRDSCQGDSGGPLVCKVKG---TWLQAGVVSWGEGCAQ 251

  Fly   414 EDIPAVYVNVPHLRGWI 430
            .:.|.:|..|.:...||
Mouse   252 PNKPGIYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 74/254 (29%)
Tryp_SPc 197..430 CDD:214473 72/252 (29%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 75/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842854
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.