DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and Prss48

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:XP_017446782.1 Gene:Prss48 / 108350052 RGDID:11436036 Length:308 Species:Rattus norvegicus


Alignment Length:254 Identity:76/254 - (29%)
Similarity:121/254 - (47%) Gaps:43/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 GEFPWMVGI-FTGRQEFLCGGTLIHPRLVVTTSHNLVNETVDTLVARAGDWDLNSLNEPYPHQGS 260
            |.:||.|.: |....  :|||:||....|:|.:|.:.......|.:   .| |.|::..|...|.
  Rat    49 GHWPWQVSLRFDSTH--ICGGSLISNHWVMTAAHCIKKTWFSFLYS---VW-LGSIDRDYSSTGE 107

  Fly   261 R--IKEIIMHSEFDPNSLYN---DIALLLLDEPIRLAPHIQPLCLPPPESPELTNQLLSVTCYAT 320
            .  :..|::     |:..:|   |||||.|...:.....:.|:|||....| ||   :..:|:.|
  Rat   108 EYYVSRIVI-----PSKHHNTDGDIALLKLSSRVTFTSLVLPICLPNISKP-LT---VPASCWVT 163

  Fly   321 GWGTKEAGSDKLEHVLKRINLPLVEREECQAKLRN---------TRLEARFRLRPSFICAGG-DP 375
            |||..:.|  .....|:.:.:|::..|.|: :|.|         .|:     ::...:|||. ..
  Rat   164 GWGQNQEG--HYPSTLQELEVPIITGEACE-QLYNPIGFFLPDLERI-----IKEDMLCAGEIQQ 220

  Fly   376 GKDTCKGDGGSPLFCQMPGEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRGWIDEKI 434
            .||:||||.|.||.|.:.|.   :..:|::|||:||. :::|.||.||.:.:.||...|
  Rat   221 SKDSCKGDSGGPLSCHIDGV---WTQIGVISWGLECG-KNLPGVYTNVTYYQKWISSII 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 75/251 (30%)
Tryp_SPc 197..430 CDD:214473 73/248 (29%)
Prss48XP_017446782.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 162 1.000 Domainoid score I3893
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8953
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.