DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:302 Identity:80/302 - (26%)
Similarity:132/302 - (43%) Gaps:57/302 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 KVDDSESPYLVKQANFKYKNCGYSNPK----GLIPDNDKFPYSEDVSIFGE------FPWMVGI- 205
            :||:|..   ||.:.....:....:|.    |:||.|     |.:.::.|:      :||...: 
Zfish   270 RVDNSSE---VKGSCINTNSQALDSPSAAVCGIIPVN-----SSNGTVGGQNSSAVHWPWQASLY 326

  Fly   206 -FTGRQEFLCGGTLIHPRLVVTTSHNLVNETVDTLVARAGDW-----DLNSLNEPYPHQGSR-IK 263
             ::|:   .|||:||:...|::.:|....:       |.|.:     ...:.|:..|.:.|| :|
Zfish   327 WYSGQ---TCGGSLINKEWVLSAAHCFNGQ-------RNGFYLTVILGPKTQNKYDPSRISRSVK 381

  Fly   264 EIIMHSEFDPNSLYNDIALLLLDEPIRLAPHIQPLCLPPPESPELTNQLLSVTCYATGWGTKEAG 328
            .:|.|..::||:..|||||:.|..||.....|:|:||....|  :.|.  ....:.|.|.....|
Zfish   382 AVIKHPYYNPNTNDNDIALVRLSFPITFTDSIRPVCLAAEGS--VFNS--DTESWITTWRNISDG 442

  Fly   329 ----SDKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRPSFICAG-GDPGKDTCKGDGGSPL 388
                |.|   :.:.:.:|::...:|..      |.....:..:.|||| ...|||.|:||.|.|:
Zfish   443 VPLPSPK---IFQEVEVPVIGNRQCNC------LYGVGSITDNMICAGLLKEGKDLCQGDSGGPM 498

  Fly   389 FCQMPGEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRGWI 430
               :..:...:...||||:|..||..:.|.||..|...:.||
Zfish   499 ---VSNQSSVWVQSGIVSFGSGCAQSEFPGVYTRVSRYQEWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 69/253 (27%)
Tryp_SPc 197..430 CDD:214473 67/251 (27%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035 0/1 (0%)
Tryp_SPc 309..537 CDD:238113 67/253 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587382
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.