DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and si:dkey-16l2.17

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:XP_001341498.1 Gene:si:dkey-16l2.17 / 100001520 ZFINID:ZDB-GENE-141212-262 Length:305 Species:Danio rerio


Alignment Length:233 Identity:72/233 - (30%)
Similarity:115/233 - (49%) Gaps:16/233 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 GEFPWMVGIFTGRQEFLCGGTLIHPRLVVTTSHNLVNET-VDTLVARAGDWDLNSLNEPYPHQGS 260
            |.:||.|.|..|....:|||::|....|::.:|...|.: |.......|...||..|:  ..:.|
Zfish    41 GSWPWQVDIQMGSNGHVCGGSIIAKNWVLSAAHCFPNPSEVSAYTLYMGRHLLNGYNQ--FEKVS 103

  Fly   261 RIKEIIMHSEF-DPNSLYNDIALLLLDEPIRLAPHIQPLCLPPPESPELTNQLLSVT-CYATGWG 323
            .::.:::...: ||.. ..|:||:.|..|:.....|||:|||..:.     |..|.| ||.||||
Zfish   104 YVQRVVIPEGYTDPQG-GRDVALVQLRAPVSWTDRIQPVCLPFADF-----QFNSGTLCYVTGWG 162

  Fly   324 TKEAG-SDKLEHVLKRINLPLVEREECQAKLRNTRLE-ARFRLRPSFICAG-GDPGKDTCKGDGG 385
            .|:.| |......|:.:.:|::::..||...:....: :...:....|||| .:.|||:|:||.|
Zfish   163 HKQEGVSLTGAAALREVEVPIIDQSSCQFMYQILSSDSSTVDILSDMICAGYKEGGKDSCQGDSG 227

  Fly   386 SPLFCQMPGEMDRYQLVGIVSWGVECAVEDIPAVYVNV 423
            .||.|  |.....:...|:||:|:.||.::.|.:|..|
Zfish   228 GPLVC--PVGNGTWIQAGVVSFGLGCAQKNRPGIYSRV 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 72/233 (31%)
Tryp_SPc 197..430 CDD:214473 72/233 (31%)
si:dkey-16l2.17XP_001341498.1 Tryp_SPc 32..273 CDD:238113 72/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587370
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.