DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and Prss22

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_006524968.4 Gene:Prss22 / 70835 MGIID:1918085 Length:365 Species:Mus musculus


Alignment Length:287 Identity:81/287 - (28%)
Similarity:132/287 - (45%) Gaps:45/287 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFVFLACLAVASAGVVPSESARAVPVKDMPRAGKIE--GRITNGYPAYEGKIPYIVGLSFNDGGY 65
            |.|.|...|..||..          ::..|..||.:  .||..|..:.:.:.|:||.: ..:|.:
Mouse    78 LLVLLTSTAPISAAT----------IRVSPDCGKPQQLNRIVGGEDSMDAQWPWIVSI-LKNGSH 131

  Fly    66 WCGGSIIDHTWVLTAAHCTNS----ANHVLIYFGA------SFRHEAQYTHWVSRSDMIQHP--D 118
            .|.||::.:.||:|||||..|    .:...:..||      ..|.:.....||     :.||  .
Mouse   132 HCAGSLLTNRWVVTAAHCFKSNMDKPSLFSVLLGAWKLGSPGPRSQKVGIAWV-----LPHPRYS 191

  Fly   119 WNDFLNNDIALIRIPH-VDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGMSN--YLN 180
            |.:..:.||||:|:.| :.|...:..:.||..:.|....:..|  .:|||...:...:.:  .|.
Mouse   192 WKEGTHADIALVRLEHSIQFSERILPICLPDSSVRLPPKTDCW--IAGWGSIQDGVPLPHPQTLQ 254

  Fly   181 CVDVQIIDNNDCRNYY----GSNYITDNTICIN-TDGGKSSCSGDSGGPLV--LHDNNRIVGIVS 238
            .:.|.|||:..|::.|    |...||:..:|.. .:|.:.:|.|||||||:  :.|:..:.||:|
Mouse   255 KLKVPIIDSELCKSLYWRGAGQEAITEGMLCAGYLEGERDACLGDSGGPLMCQVDDHWLLTGIIS 319

  Fly   239 FGSGEGCT-AGRPAGFTRVTGYLDWIR 264
            :  ||||. ..||..:|.:..:..|::
Mouse   320 W--GEGCAERNRPGVYTSLLAHRSWVQ 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 71/245 (29%)
Tryp_SPc 41..266 CDD:238113 71/247 (29%)
Prss22XP_006524968.4 Tryp_SPc 108..346 CDD:238113 71/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.