DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and cela2a

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_017945752.1 Gene:cela2a / 594883 XenbaseID:XB-GENE-970278 Length:269 Species:Xenopus tropicalis


Alignment Length:282 Identity:91/282 - (32%)
Similarity:129/282 - (45%) Gaps:44/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFVFLACLAVASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGYW- 66
            |.|.:.|||.|....||:..             .:..|:.||........|:.|.|.:...||| 
 Frog     4 LLVLVLCLAGAYCCGVPTYQ-------------PVVSRVVNGEDVAPHSWPWQVSLQYLYYGYWY 55

  Fly    67 --CGGSIIDHTWVLTAAHCTNSANHVLIYFGASFRHEAQYTH----WVSRSDMIQHPDWN-DFLN 124
              ||||:|...||||||||.:|.|...:..|   :|..:|..    .::.|.:|.||.|: :.|.
 Frog    56 HTCGGSLISSNWVLTAAHCISSYNTYRVQLG---KHNLRYIEPGQKIINVSKLINHPRWDPNSLG 117

  Fly   125 N--DIALIRIPH-VDFWSLVNKVELPSYN----DRYNSYSGWWAVASGWGLTDNNSGMSNYLNCV 182
            |  ||:||::.. |||...|....||...    .:|..|      .:|||.........:.|...
 Frog   118 NGFDISLIKLEESVDFSDTVQPACLPPAGYILPHQYGCY------VTGWGNIRTGGPEPDILQQG 176

  Fly   183 DVQIIDNNDCR--NYYGSNYITDNTICINTDGGKSSCSGDSGGPLVLHDNN---RIVGIVSFGSG 242
            .:.::|...|.  :::|.. :..|.||...||..|||:|||||||...:.|   .:.|:|||||.
 Frog   177 LLLVVDYATCSQWDWWGDG-VRTNMICAGGDGITSSCNGDSGGPLNCRNANGTWEVHGVVSFGSA 240

  Fly   243 EGCT-AGRPAGFTRVTGYLDWI 263
            .||. ..:|:.|:||:.:..||
 Frog   241 AGCNYPKKPSVFSRVSEFNSWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 81/243 (33%)
Tryp_SPc 41..266 CDD:238113 82/244 (34%)
cela2aXP_017945752.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.