DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG18754

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:299 Identity:65/299 - (21%)
Similarity:109/299 - (36%) Gaps:81/299 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VFLACLAVASAGVVPSES--ARAVPVKDMPRAGKIEGRITNGYP-----AYEGKIPYIVGLSFND 62
            |::.|..:..  |:|::.  .:..||.   |....|....|.||     .||.::..|       
  Fly    80 VYVCCPELGD--VLPNKQTCGQTTPVF---RDRGAENAELNEYPWMVLLLYENRLSLI------- 132

  Fly    63 GGYWCGGSIIDHTWVLTAAHCT----NSANHVLIYFGASFRHEAQYTHWVSRSDMIQHPD----- 118
                        .:|||||||.    .:.|.:::   .|.|.....|..::......|.|     
  Fly   133 ------------RYVLTAAHCVIGGYLTQNDLVL---KSVRLGESTTDCITSESRCPHLDVEVGQ 182

  Fly   119 ---WNDFLN------NDIALIRIPH-VDFWSLVNKV-----ELPSYNDRYNSYSGWWAVASGWGL 168
               ...|.:      |||||:|:.. |.:...:..:     |.| ..|.....|||....|...|
  Fly   183 TTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFP-LQDLNLQISGWDPTKSSQTL 246

  Fly   169 TDNNSGMSNYLNCVDVQIIDNN--DCRNYYGSNYITDNTICINTDGGKSSCSGDSGGPLV----- 226
                         :...:.:.|  ||.|.|.| :.:.:.:|........:|:|.||.|::     
  Fly   247 -------------ITSTVKERNPADCLNRYPS-FRSASQVCAGGQRKGDTCAGISGSPVMGIMGS 297

  Fly   227 -LHDNNRIVGIVSFGSGEGCTAGRPAGFTRVTGYLDWIR 264
             :.:...:.||.|:|.....:||.|..:|::..:.:||:
  Fly   298 GVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIK 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 55/259 (21%)
Tryp_SPc 41..266 CDD:238113 57/261 (22%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855 1/3 (33%)
Tryp_SPc 108..338 CDD:238113 58/266 (22%)
Tryp_SPc 108..335 CDD:214473 56/263 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435657
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.