DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG34409

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:309 Identity:83/309 - (26%)
Similarity:129/309 - (41%) Gaps:75/309 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VVPSESARAVPVKDMPRA-------------------G-KIEGRITNGYPAYEGKIPYIVGLSFN 61
            :.|..:..|.|::.:|.:                   | .:|.|:..|..|..|:.|::..:::.
  Fly   206 LAPFTTTLATPIETIPASLSTTTASMPPFAQENTQGCGINVESRLLGGDQASAGQFPWLTRIAYR 270

  Fly    62 DG-----GYWCGGSIIDHTWVLTAAHCTNS------ANHVLI--YFGAS-FRHEAQYTHWVSRSD 112
            :.     .:.|.||:|....::|||||..:      .:||.:  ..||: |..|          .
  Fly   271 NRSSSRISFRCSGSLISSNHIVTAAHCVVNLVSDLELSHVRLGSQDGATPFAIE----------Q 325

  Fly   113 MIQHPDWND-FLNNDIALIRIPHVDFWSLVNKVELPSYNDRY---NSYSGWWAVASGW--GLTDN 171
            :|.||:::. ...|||||:||...:  .....:.|| :|...   |...|...||:||  |.|:|
  Fly   326 VIVHPNYDQPKYANDIALLRINSTN--GTFTPICLP-FNGPITLGNRLIGQIGVAAGWSIGSTEN 387

  Fly   172 NSGM--SNY---LNCVDVQIIDNNDCRNYYGS---NY-----ITDNTICINTDGGKSSCSGDSGG 223
            ||.|  ||.   :..:.:.|::...|...|.|   |:     ||.|.:|.........|.|||||
  Fly   388 NSSMDPSNSTAGVRFIRLPIVNTTSCAIAYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGG 452

  Fly   224 PL-------VLHDNNR--IVGIVSFGSGEGCTAGRPAGFTRVTGYLDWI 263
            |.       |...:.|  |:|||:||.........|..:|.|:.:.|||
  Fly   453 PFMDDGTSGVFGTSGRYTIIGIVAFGPTLCGVTTIPGVYTLVSSFSDWI 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 75/264 (28%)
Tryp_SPc 41..266 CDD:238113 76/265 (29%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 75/264 (28%)
Tryp_SPc 252..501 CDD:238113 74/261 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435664
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.