DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG34171

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:260 Identity:60/260 - (23%)
Similarity:106/260 - (40%) Gaps:48/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 NGY--PAYEGKIPYIVGLSFN------DGGYWCGGSIIDHTWVLTAAHCTNSANHVLI------- 92
            |.|  |.|.....|:|.|...      ...::|.|.|:.:..|||:|||....|.|::       
  Fly    25 NHYHEPTYSHLSSYLVSLRTRKYIHTPGDNHFCTGVILTNRHVLTSAHCITDKNGVMMSPKRIVV 89

  Fly    93 -YFGASFRHEAQYTHWVSRSDMIQHPDWNDFLNNDIALIRIPHVDFWSLVNKVELPSY------- 149
             ...:.|:........|...:||.||.::...:||||:|:        |...|:|..:       
  Fly    90 ALCASLFKTPESEEFVVDIHNMIIHPYYHRNQHNDIAIIK--------LKRYVKLDGHHLAPVVL 146

  Fly   150 -NDRYNSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDC----RNYYGSNYITDNTICIN 209
             |......:....:...:|:.....|..:.:..|:|::...::|    ::...:....::.||:.
  Fly   147 GNSSLEVGNDCKTIGGIFGVRRQRFGSFHSMLLVNVELRPFDECLKVKKSLMAARPENEDLICVK 211

  Fly   210 TDGGKSSCSGDSGGPLVLHDNNRIVGIVSFGSGEGCTAGRPAGFTRVTGYLDWIR-------DHT 267
            :. .|..|:.|.||||..  :.::.|| :.|| ..|::..|..|:.|:.|..|:.       |||
  Fly   212 ST-EKQMCTTDFGGPLFC--DGQLYGI-ALGS-INCSSPDPVFFSDVSFYNSWVTKIISEAVDHT 271

  Fly   268  267
              Fly   272  271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 56/247 (23%)
Tryp_SPc 41..266 CDD:238113 57/257 (22%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 54/243 (22%)
Tryp_SPc 38..263 CDD:304450 53/237 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471240
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.