DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and cela1.4

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001020358.1 Gene:cela1.4 / 574008 ZFINID:ZDB-GENE-050626-127 Length:267 Species:Danio rerio


Alignment Length:250 Identity:84/250 - (33%)
Similarity:124/250 - (49%) Gaps:37/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IEGRITNGYPAYEGKIPYIVGLSF---NDGGYWCGGSIIDHTWVLTAAHCTNSANHVLIYFGAS- 97
            ||.|:..|..|.....|:.:.|.|   .|..:.|||::|...||||||||.:...:..:..|.. 
Zfish    26 IEERVVGGEVAKPNSWPWQISLQFLSALDYFHTCGGTLIRPGWVLTAAHCVDIPRNWRVILGDHD 90

  Fly    98 -FRHEA-QYTHWVSRSDMIQHPDWN-DFLNN--DIALIRI-------PHVDFWSL--VNKVELPS 148
             .:||. :.:..|||  :..||:|| |.:::  ||||:::       .:|...:|  ..:| ||.
Zfish    91 ITKHEGHEQSLTVSR--VYIHPNWNTDSVSSGYDIALLQLSTDATLNSYVQLATLPPAGQV-LPH 152

  Fly   149 YNDRYNSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDC-RNYYGSNYITDNTICINTDG 212
            .|:.|         .:|||.|......|:.|....:.::|:|.| |:.:..:.:.|..||  :.|
Zfish   153 NNECY---------ITGWGRTQTGGSTSSQLKQALLPVVDHNTCSRSDWWGSIVKDTMIC--SGG 206

  Fly   213 GK-SSCSGDSGGPLVLHDNNRIV--GIVSFGSGEGC-TAGRPAGFTRVTGYLDWI 263
            |: |.|.|||||||....|.:.|  |:.||.|..|| |..:|..||||:.|..||
Zfish   207 GEVSGCQGDSGGPLNCLVNGKYVVHGVTSFVSAAGCNTNKKPTVFTRVSAYNSWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 80/245 (33%)
Tryp_SPc 41..266 CDD:238113 80/245 (33%)
cela1.4NP_001020358.1 Tryp_SPc 29..261 CDD:214473 80/245 (33%)
Tryp_SPc 30..264 CDD:238113 80/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.