DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and Prss21

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_065233.2 Gene:Prss21 / 57256 MGIID:1916698 Length:324 Species:Mus musculus


Alignment Length:247 Identity:74/247 - (29%)
Similarity:120/247 - (48%) Gaps:24/247 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IEGRITNGYPAYEGKIPYIVGLSFNDGGYWCGGSIIDHTWVLTAAHCTNSANHVL---IYFG--- 95
            |..||..|..|..|:.|:...|.. .|.:.||.::::..||||||||....|...   :.||   
Mouse    51 IPSRIVGGDDAELGRWPWQGSLRV-WGNHLCGATLLNRRWVLTAAHCFQKDNDPFDWTVQFGELT 114

  Fly    96 --ASFRHEAQYTHWVSRSDMIQHPDWNDFLNNDIALIRIPH-VDFWSLVNKVELPSYNDRYNSYS 157
              .|..:...|::.....|:...|.:::...|||||:::.. |.:.:.:..:.|.:...::.:.:
Mouse   115 SRPSLWNLQAYSNRYQIEDIFLSPKYSEQYPNDIALLKLSSPVTYNNFIQPICLLNSTYKFENRT 179

  Fly   158 GWWAVASGWGL--TDNNSGMSNYLNCVDVQIIDNNDCRNYYGS----NYITDNTICINT-DGGKS 215
            ..|  .:|||.  .|.:....|.|..|.|.||:|:.|.:.|..    ..|..:.:|..| :|||.
Mouse   180 DCW--VTGWGAIGEDESLPSPNTLQEVQVAIINNSMCNHMYKKPDFRTNIWGDMVCAGTPEGGKD 242

  Fly   216 SCSGDSGGPLVLHDNNRI---VGIVSFGSGEGCTAGRPAGFTRVTGYLDWIR 264
            :|.|||||||.. |.:.:   ||:||:|.|.| ...||..:|.::.:.:||:
Mouse   243 ACFGDSGGPLAC-DQDTVWYQVGVVSWGIGCG-RPNRPGVYTNISHHYNWIQ 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 71/241 (29%)
Tryp_SPc 41..266 CDD:238113 72/243 (30%)
Prss21NP_065233.2 Tryp_SPc 54..291 CDD:214473 71/241 (29%)
Tryp_SPc 55..294 CDD:238113 72/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.