DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and cela1.1

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001020645.2 Gene:cela1.1 / 553249 ZFINID:ZDB-GENE-050522-187 Length:282 Species:Danio rerio


Alignment Length:254 Identity:80/254 - (31%)
Similarity:124/254 - (48%) Gaps:31/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IEGRITNGYPAYEGKIPYIVGLSFNDGG---YWCGGSIIDHTWVLTAAHCTNSANHVLIYFGASF 98
            ||.|:..|..|.....|:.:.|.:..||   ::|||::|...||:.||||.:::.   |:..|..
Zfish    26 IEERVIGGEIAKPHSWPWQISLQYQSGGRYHHYCGGTLIRPGWVMVAAHCVDTSR---IWSVALG 87

  Fly    99 RHEAQYTH-----WVSRSDMIQHPDWNDFL---NNDIALIRIP-HVDFWSLVNKVELPSYND--R 152
            .|:.. ||     ::|...:..||:||..:   .|||||:::. :....|.|....||||.:  .
Zfish    88 DHDTT-THEGPEQYISVKGVFIHPNWNPNIVANGNDIALLQLSINATLSSYVQVATLPSYGEILP 151

  Fly   153 YNSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDC--RNYYGSNYITDNTICINTDGGKS 215
            |    |.....:|||.|.....:|..|....:.::|:..|  .:::||. :.|..||.......|
Zfish   152 Y----GHTCYITGWGRTQTGGSLSAQLKQAYMPVVDHETCSQSDWWGST-VKDRMICAGGTTSMS 211

  Fly   216 SCSGDSGGPLVLHDNNRIV--GIVSFGSGEGC-TAGRPAGFTRVTGYLDWIRDHTGIVY 271
            :|.||||.||....|...|  |:.||.:..|| |..:|..||||:.::.|: :|  |:|
Zfish   212 ACHGDSGSPLNCLFNGEYVVHGVTSFVASSGCNTYKKPTVFTRVSYHVSWL-NH--IMY 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 74/241 (31%)
Tryp_SPc 41..266 CDD:238113 74/243 (30%)
cela1.1NP_001020645.2 Tryp_SPc 29..261 CDD:214473 74/240 (31%)
Tryp_SPc 30..265 CDD:238113 75/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.