DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and prss27

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_031749235.1 Gene:prss27 / 496619 XenbaseID:XB-GENE-5744470 Length:724 Species:Xenopus tropicalis


Alignment Length:293 Identity:94/293 - (32%)
Similarity:138/293 - (47%) Gaps:65/293 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LACLAVASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSF-NDGGYWCGGS 70
            |..|.....|:.|..:...:|:        :..||..|..|.||:.|:.|  || |:||::|||:
 Frog     8 LLLLTPGLLGITPGATDCGIPL--------VSSRIMGGQSAQEGQWPWQV--SFRNNGGHFCGGT 62

  Fly    71 IIDHTWVLTAAHC---TNSANHVLIYFGASFRHEAQYTHWVSRSDMIQHPDWN------------ 120
            :|...:|::||||   ::||:.|....||.               ||..||.|            
 Frog    63 LISKQYVISAAHCFPSSSSASSVTAVLGAY---------------MIDQPDGNQVAIPVQSATNY 112

  Fly   121 -DFLN----NDIALIRIPH-VDFWSLVNKVELPSYNDRYNSYSGWWAVASGWG--LTDNNSGMSN 177
             .::|    .||:|:::.. |.|.:.:..|.||:  |.....:|.....:|||  .:|.:.....
 Frog   113 PSYVNEGDSGDISLVQLASPVTFTNYILPVCLPA--DTVTFPTGLQCWVTGWGNIASDVSLVSPM 175

  Fly   178 YLNCVDVQIIDNNDCR------NYYGSNYIT--DNTICIN-TDGGKSSCSGDSGGPLVLHDNNR- 232
            .|..|.|.:||.|:|.      |.||::.|:  .:.||.. .:|||.||.||||||||...:.: 
 Frog   176 TLQEVAVPLIDANECNALYQTPNSYGTSSISVHSDMICAGFINGGKDSCQGDSGGPLVCSSSGQW 240

  Fly   233 -IVGIVSFGSGEGC-TAGRPAGFTRVTGYLDWI 263
             :.|:|||  |||| .|.||..:|.:..|.|||
 Frog   241 FLAGVVSF--GEGCGQAYRPGVYTLMPSYTDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 87/258 (34%)
Tryp_SPc 41..266 CDD:238113 88/259 (34%)
prss27XP_031749235.1 Tryp_SPc 34..271 CDD:238113 86/257 (33%)
Tryp_SPc 420..659 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.