DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and cela1.6

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001003737.1 Gene:cela1.6 / 445282 ZFINID:ZDB-GENE-040808-55 Length:266 Species:Danio rerio


Alignment Length:284 Identity:85/284 - (29%)
Similarity:130/284 - (45%) Gaps:51/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFVFLACLAVASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGG--- 64
            |...||.||:|....:..:.|              :.|:..|..|.....|:.:.|.:..||   
Zfish     6 LLSVLAALALAEPRYLEEQIA--------------QERVVGGEVARPNSWPWQISLQYLSGGSYY 56

  Fly    65 YWCGGSIIDHTWVLTAAHCTNSANHVLIYFGAS--FRHEAQYTHWVSRSDMIQHPDWNDFLNN-- 125
            :.|||::|...:|||||||.:::....:..|..  ::.|.: ..:::.|::..||:||  .||  
Zfish    57 HTCGGTLIKQNFVLTAAHCVDTSRTWRVVLGEHDIYKQEGR-EQYMTVSNVYIHPNWN--RNNVA 118

  Fly   126 ---DIALIRI-------PHVDFWSLVNKVE-LPSYNDRYNSYSGWWAVASGWGLTDNNSGMSNYL 179
               ||||:|:       .:|...:|....: ||..|..|         .:|||||.....:|..|
Zfish   119 AGYDIALLRLSSNASLNTYVQLGTLPPSGQVLPHNNACY---------ITGWGLTSTGGSLSAQL 174

  Fly   180 NCVDVQIIDNNDCR--NYYGSNYITDNTICINTDGGKSSCSGDSGGPLVLHDNNRIV--GIVSFG 240
            ....:.::|.|.|.  :::||.  ..||:.....|..|.|.|||||||....:.:.|  |:.||.
Zfish   175 KQAYLPVVDYNTCSRGDWWGST--VKNTMVCAGGGSLSGCQGDSGGPLNCQVSGQYVVHGVTSFV 237

  Fly   241 SGEGCTA-GRPAGFTRVTGYLDWI 263
            |..||.| .:|..||||:.|:.||
Zfish   238 SSSGCNAYQKPTVFTRVSAYISWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 76/245 (31%)
Tryp_SPc 41..266 CDD:238113 77/246 (31%)
cela1.6NP_001003737.1 Tryp_SPc 30..264 CDD:238113 77/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.