DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and cela1.3

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_021324991.1 Gene:cela1.3 / 445032 ZFINID:ZDB-GENE-040801-12 Length:283 Species:Danio rerio


Alignment Length:252 Identity:85/252 - (33%)
Similarity:124/252 - (49%) Gaps:37/252 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IEGRITNGYPAYEGKIPYIVGLSFNDGG---YWCGGSIIDHTWVLTAAHCTNSANHVLIYFGAS- 97
            ||||:..|..|.....|:.:.|.:..|.   :.||||:|...||:|||||.:|.....:..|.. 
Zfish    41 IEGRVVGGEVAKPNSWPWQISLQYLSGSSYYHTCGGSLIRPGWVMTAAHCVDSPRTWRVVLGDHD 105

  Fly    98 -FRHEA--QYTHWVSRSDMIQHPDWN-DFLNN--DIALIRI-------PHVDFWSLVNKVE-LPS 148
             :.||.  ||.. |||:.:  ||:|| :.|::  ||||:.:       .:|...:|....: ||:
Zfish   106 IYNHEGREQYIS-VSRAHI--HPNWNSNSLSSGYDIALLELSSDASLNSYVQLAALPPSGQVLPN 167

  Fly   149 YNDRYNSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDC--RNYYGSNYITDNTICINTD 211
            .|..|         .||||.|.....:|..|....:.::|::.|  .:::||.  ..||:....|
Zfish   168 NNPCY---------ISGWGRTQTGGSLSAELKQAYLPVVDHDTCSRSDWWGST--VKNTMICGGD 221

  Fly   212 GGKSSCSGDSGGPLVLHDNNRIV--GIVSFGSGEGC-TAGRPAGFTRVTGYLDWIRD 265
            |..:.|.|||||||....:.:.|  |:.||.|..|| |..||..|:||:.|:.||.|
Zfish   222 GTLAGCHGDSGGPLNCQVSGQYVVHGVTSFVSSAGCNTNKRPTVFSRVSAYISWIND 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 79/245 (32%)
Tryp_SPc 41..266 CDD:238113 81/248 (33%)
cela1.3XP_021324991.1 Tryp_SPc 45..279 CDD:238113 81/248 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.