DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CTRB2

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001020371.3 Gene:CTRB2 / 440387 HGNCID:2522 Length:263 Species:Homo sapiens


Alignment Length:230 Identity:76/230 - (33%)
Similarity:119/230 - (51%) Gaps:10/230 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RITNGYPAYEGKIPYIVGLSFNDGGYWCGGSIIDHTWVLTAAHCTNSANHVLIYFGASFRHEAQY 104
            ||.||..|..|..|:.|.|....|.::||||:|...||:|||||....:.|::........:.:.
Human    33 RIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEEN 97

  Fly   105 THWVSRSDMIQHPDWNDF-LNNDIALIRI-PHVDFWSLVNKVELPSYNDRYNSYSGWWAVASGWG 167
            ...:..:.:.::|.::.. :||||.|::: ....|...|:.|.|||.:|.:.  :|.....:|||
Human    98 IQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFP--AGTLCATTGWG 160

  Fly   168 LTDNNSGMS-NYLNCVDVQIIDNNDCRNYYGSNYITDNTICINTDGGKSSCSGDSGGPLVLHDNN 231
            .|..|:..: :.|....:.::.|.:|:..:|.. |||..||... .|.|||.||||||||...:.
Human   161 KTKYNANKTPDKLQQAALPLLSNAECKKSWGRR-ITDVMICAGA-SGVSSCMGDSGGPLVCQKDG 223

  Fly   232 --RIVGIVSFGSGEGCTAGRPAGFTRVTGYLDWIR 264
              .:|||||:|| ..|:...||.:.||...:.|::
Human   224 AWTLVGIVSWGS-RTCSTTTPAVYARVAKLIPWVQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 75/227 (33%)
Tryp_SPc 41..266 CDD:238113 75/229 (33%)
CTRB2NP_001020371.3 Tryp_SPc 33..256 CDD:214473 75/227 (33%)
Tryp_SPc 34..259 CDD:238113 75/229 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.