DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG9737

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:263 Identity:80/263 - (30%)
Similarity:125/263 - (47%) Gaps:36/263 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KIEGRITNGYPAYEGKIPYIVGLSFNDGGYWCGGSIIDHTWVLTAAHCT--------NSANHV-L 91
            ::..||..|..|...:.|::..|.:|...|.|.|::||...:||||||.        ....|| |
  Fly   145 QVTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRL 209

  Fly    92 IYFGASFRHEA-QYTHWVSRSD---------MIQHPDWNDFLN---NDIALIRIPH-VDFWSLVN 142
            ..|......:. :..:::|.:|         :..||::.:|.|   ||||:||:.| |.|...|.
  Fly   210 GEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVM 274

  Fly   143 KVELPSYNDRYNSYSGWWAVASGWGLTD-NNSGMSNYLNCVDVQI----IDNNDCRNY---YGSN 199
            .:.||:.::......|.....||||.|| .|....|..:.:.:::    :.|.:|...   :|..
  Fly   275 PICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNENCTKILEGFGVR 339

  Fly   200 YITDNTICINTDGGKSSCSGDSGGPLVLHD--NNRIV--GIVSFGSGEGCTAGRPAGFTRVTGYL 260
             :....||...:..|.:|:|||||||:..|  ::|.|  |:||:|..:...||:||.:|.|..|.
  Fly   340 -LGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYT 403

  Fly   261 DWI 263
            |||
  Fly   404 DWI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 78/257 (30%)
Tryp_SPc 41..266 CDD:238113 79/258 (31%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 78/257 (30%)
Tryp_SPc 150..409 CDD:238113 79/258 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.