DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG11841

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:256 Identity:69/256 - (26%)
Similarity:120/256 - (46%) Gaps:48/256 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ITNGYPAYEGKIPYIVGLSF----NDGGYWCGGSIIDHTWVLTAAHCTNSANHV--LIYFGASFR 99
            |.:|.||...:.|:...|..    |:..::|||::|.:..|||||||..|.:..  ::..|    
  Fly    72 IVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLG---- 132

  Fly   100 HEAQY---THWVSRSD-----MIQHPDW-NDFLNNDIALIRIP-HVDFWSLVNKVELPS---YND 151
             |.::   |......|     :..||.: |..|.|||.::::. .|.|    |:.:.|:   ::|
  Fly   133 -ELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKF----NRYKHPACLPFDD 192

  Fly   152 --RYNSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQ-----IIDNNDCRNYYGSNYITDNTICIN 209
              ::.|:     :|.|||........|..|..|.:|     .:.:.|..:...:.|...:.:||.
  Fly   193 GEQHESF-----IAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPNGYEPKSQLCIG 252

  Fly   210 TDGGKSSCSGDSGGPLVLHDNN-----RIVGIVSFGSGEGC-TAGRPAGFTRVTGYLDWIR 264
            :...|.:|:||||||::.:..:     .::||.|  :|..| |...|:.:|||..:|:||:
  Fly   253 SRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITS--AGITCSTPDIPSAYTRVHYFLNWIK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 67/253 (26%)
Tryp_SPc 41..266 CDD:238113 69/256 (27%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 68/254 (27%)
Tryp_SPc 72..310 CDD:214473 67/253 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437102
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.