DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG4815

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:258 Identity:60/258 - (23%)
Similarity:97/258 - (37%) Gaps:57/258 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GKIEGRITNGYPAYEGKIPYIVGLSFNDGGYWCGGSIIDHTWVLTAAHCTNSAN----HVLIYFG 95
            |:...||.||.......:..:....||.....|..:::....:||||||..:.|    ||:   |
  Fly    29 GRFHPRIYNGIKTTVESLGGVGIQLFNGRKLVCSATLLTPRHILTAAHCFENLNRSKFHVI---G 90

  Fly    96 ASFRHEAQYTHWVSRSDMIQHPDW--NDFLNNDIALIRIPHVDFWSL-------VNKVELPSYND 151
            ..   .|::|             |  |:|..|.:..::| |..:..:       |.|.:.| ...
  Fly    91 GK---SAEFT-------------WHGNNFNKNKLIRVQI-HPKYAKMKFIADVAVAKTKYP-LRS 137

  Fly   152 RYNSYSGWW---------AVASGWGLTDN--NSGMSNYLNCVDVQIIDNNDCRNYYGSNYITDNT 205
            :|..|:...         .:|:|||....  :.........:.|.|:...||.... ...:..|.
  Fly   138 KYIGYAQLCRSVLHPRDKLIAAGWGFEGGVWDESRKKTFRSMKVGIVSKRDCEKQL-DRKMPPNI 201

  Fly   206 ICINTDGGKSSCSGDSGGPLVLHDNNRIVGIVSF----GSGEGCTAGRPAGFTRVTGYLDWIR 264
            ||......|:.|.|||||||:|  ..::.||.::    |:.|     :|..:..|..|..:|:
  Fly   202 ICAGAYNNKTLCFGDSGGPLLL--GRQVCGINTWTFKCGNNE-----KPDVYMGVRYYAKFIK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 58/250 (23%)
Tryp_SPc 41..266 CDD:238113 58/252 (23%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 55/238 (23%)
Trypsin 49..256 CDD:278516 54/235 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471144
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.