DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG31219

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:287 Identity:74/287 - (25%)
Similarity:110/287 - (38%) Gaps:94/287 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GKIEGRITNGYPAYEGKIPYIVG-----LSFNDGGYWCGGSIIDHTWVLTAAHCTNSANHVL--- 91
            |..|.| .|||| :...:.|:..     |.|      |.||:|::.:|||:|||.|.....|   
  Fly    91 GGSEAR-PNGYP-WMAMLLYLNTTTLEILPF------CAGSLINNRYVLTSAHCVNGIPRDLSLK 147

  Fly    92 -IYFGASFRHEAQYTHWVSRSDMIQHPDWNDFLNN-----------------------------D 126
             :..|   .|:..|       |...:||..|..|.                             |
  Fly   148 SVRLG---EHDITY-------DPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYD 202

  Fly   127 IALIRIP-HVDFWSLVNKVELPSYNDRYNSYSGWWAVA----SGWGLTDNNSGMSNYLNCVDVQI 186
            |||:|:. .|.:.:.:..:.:|.:        |::|.:    :|||.|  |.|..:       |:
  Fly   203 IALLRLKMPVRYRTGIMPICIPKH--------GFFAKSKLEIAGWGKT--NEGQFS-------QV 250

  Fly   187 IDNNDCRN-----------YYGSNYITDNTICINTDGGKSSCSGDSGGPL-VLHDNNRI--VGIV 237
            :.:...|.           |...|....  ||.....|..:|.||||||| |..||:.:  .||.
  Fly   251 LMHGFIRERSIAVCALRFPYLDLNQSLQ--ICAGGYDGVDTCQGDSGGPLMVTMDNSSVYLAGIT 313

  Fly   238 SFGSGEGCTAGRPAGFTRVTGYLDWIR 264
            ::||......|.|..:||.:.:|.||:
  Fly   314 TYGSKNCGQIGIPGIYTRTSAFLPWIK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 70/279 (25%)
Tryp_SPc 41..266 CDD:238113 71/281 (25%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 72/284 (25%)
Tryp_SPc 90..342 CDD:238113 74/287 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435658
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.