DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG5246

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:283 Identity:88/283 - (31%)
Similarity:128/283 - (45%) Gaps:48/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LACLAVASAGVVPSE-SARAVPVKDMPRAG------KIEGRITNGYPAYEGKIPYIVGLSFNDGG 64
            :.||.:.|..|:.|: ||::|.:....:..      |.|.|:..|..:..|..||.|.:....|.
  Fly     1 MKCLVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFGE 65

  Fly    65 YWCGGSIIDHTWVLTAAHC-----------TNSANHVLIYFGASFRHEAQYTHWVSRSDMIQHPD 118
            :.||||||...|:||||||           |.:.::...  ||.:..:....| .|......|  
  Fly    66 HVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTRP--GAEYLVDGSKIH-CSHDKPAYH-- 125

  Fly   119 WNDFLNNDIALIR----IPHVDFW---SLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGMS 176
                  ||||||.    |.:.|..   .|.:|..||...|:        ...:|||.|......|
  Fly   126 ------NDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDK--------LTLTGWGSTKTWGRYS 176

  Fly   177 NYLNCVDVQIIDNNDCRN-YYGSNYITDNTICINTDGGKSSCSGDSGGPLVLHDNNRIVGIVSFG 240
            ..|..:|:..||:::|:: ...:|::::..:|..|..|:.||.|||||||| ..|..:||:|:: 
  Fly   177 TQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPLV-DANQTLVGVVNW- 239

  Fly   241 SGEGCTAGRPAGFTRVTGYLDWI 263
             ||.|..|.|..|..|..|.|||
  Fly   240 -GEACAIGYPDVFGSVAYYHDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 76/241 (32%)
Tryp_SPc 41..266 CDD:238113 77/242 (32%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 76/241 (32%)
Tryp_SPc 42..263 CDD:238113 77/242 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436760
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.