DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG17475

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:290 Identity:90/290 - (31%)
Similarity:128/290 - (44%) Gaps:59/290 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFVFLACLAVASAGVVPSESARAVPVKD--MPRAGKIEG-----RITNGYPAYEGKIPYIVGLSF 60
            |.:.|||....     |..:.|...:.:  :....|.||     |:.||.....|:..|.:.|..
  Fly    10 LVILLACTCYK-----PISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISLQG 69

  Fly    61 NDGGYWCGGSIIDHTWVLTAAHCTNSAN--HVLIYFGA--SFRHEAQY---THWVSRSDMIQHPD 118
            ..||:.|||.|||...|||||||....|  ::.:..|.  ..:.:|.|   .||:       |.:
  Fly    70 MYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEKPDAVYFVEEHWI-------HCN 127

  Fly   119 WN--DFLNNDIALIRI-PHVDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTD---------N 171
            :|  |: :|||||||: ..:.|.......|||:    ....:|...:.:|||.|:         .
  Fly   128 YNSPDY-HNDIALIRLNDTIKFNEYTQPAELPT----APVANGTQLLLTGWGSTELWGDTPDILQ 187

  Fly   172 NSGMSN--YLNCVDVQIIDNNDCRNYYGSNYITDNTICINTDGGKSSCSGDSGGPLVLHDNNRIV 234
            .:.:::  |..|   |.|.|||..|  |..:     ||..|.||:.:|.|||||||.  .|..:.
  Fly   188 KAYLTHVVYSTC---QEIMNNDPSN--GPCH-----ICTLTTGGQGACHGDSGGPLT--HNGVLY 240

  Fly   235 GIVSFGSGEGCTAGRPAGFTRVTGYLDWIR 264
            |:|::  |..|..|.|.....|..||:|||
  Fly   241 GLVNW--GYPCALGVPDSHANVYYYLEWIR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 78/243 (32%)
Tryp_SPc 41..266 CDD:238113 80/245 (33%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 78/243 (32%)
Tryp_SPc 50..269 CDD:238113 80/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436762
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.