DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG31265

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:284 Identity:87/284 - (30%)
Similarity:127/284 - (44%) Gaps:49/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLACLAVASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGY 65
            |||......:.:|.....|.||.|.|.    |......|||..|..|..|..||.|.|....|.:
  Fly     1 MKLLRLSLLILLAVKPPNPCESKRIVG----PFPAGQSGRIKGGEEAEIGFAPYQVSLQPIVGSH 61

  Fly    66 WCGGSIIDHTWVLTAAHCTNSANHVLIYF----------GASFRHEAQYTHWVSRSDMIQHPDWN 120
            .|||:|::..|::||.||..:....|:..          ||.:     ||..:.:..|...|   
  Fly    62 NCGGAILNENWIITAGHCVENFIPALVNVITGTNKWAEPGAIY-----YTAEIHKHCMYDQP--- 118

  Fly   121 DFLNNDIALIRI-PHVDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGMS-NYLNCVD 183
             :::|||||::: .::.|..|...:.||:...:.    |...|.:||| :|...|.| ..|:.:.
  Fly   119 -YMHNDIALVKLTENITFNELTQPIALPTRPVQL----GEEIVLTGWG-SDVAYGSSMEDLHKLT 177

  Fly   184 VQIIDNNDCRNYYGSNYITDNT--------ICINTDGGKSSCSGDSGGPLVLHDNNRIVGIVSFG 240
            |.::..::|       |.|.|.        ||..:..|:.:|.||||||||  .|.::||:|:: 
  Fly   178 VGLVPLDEC-------YETFNRTSSMGVGHICTFSREGEGACHGDSGGPLV--SNGQLVGVVNW- 232

  Fly   241 SGEGCTAGRPAGFTRVTGYLDWIR 264
             |..|..|.|.....|..||||||
  Fly   233 -GRPCGVGLPDVQANVYYYLDWIR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 73/242 (30%)
Tryp_SPc 41..266 CDD:238113 75/244 (31%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 73/242 (30%)
Tryp_SPc 39..257 CDD:238113 74/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.