DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG17477

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:242 Identity:73/242 - (30%)
Similarity:101/242 - (41%) Gaps:30/242 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IEGRITNGYPAYEGKIPYIVGLSFNDGGYWCGGSIIDHTWVLTAAHCTNS--------ANHVLIY 93
            :|..|..|..|.||..||.|.|....|.:.|||:||...|::||.||...        |...:.|
  Fly    23 LEHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRY 87

  Fly    94 F--GASFRHEAQYTHWVSRSDMIQHPDWNDFLNNDIALIRI-PHVDFWSLVNKVELPSYNDRYNS 155
            .  ||.:..:|.|.|....|...|         |||.|:.: ..:.|.:|...||||:......:
  Fly    88 AEPGAVYYPDAIYLHCNYDSPKYQ---------NDIGLLHLNESITFNALTQAVELPTSPFPRGA 143

  Fly   156 YSGWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDCRNY---YGSNYITDNTICINTDGGKSSC 217
            ..   .|.:|||.......:.:.|..|..|.:::..|.:.   |....:....||........:|
  Fly   144 SE---LVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGAC 205

  Fly   218 SGDSGGPLVLHDNNRIVGIVSFGSGEGCTAGRPAGFTRVTGYLDWIR 264
            .|||||||| |... :|||::|  ...|..|.|..|..:..|.||:|
  Fly   206 HGDSGGPLV-HQGT-LVGILNF--FVPCAQGVPDIFMNIMYYRDWMR 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 70/236 (30%)
Tryp_SPc 41..266 CDD:238113 72/238 (30%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 72/238 (30%)
Tryp_SPc 27..246 CDD:214473 69/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.