DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and modSP

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:234 Identity:58/234 - (24%)
Similarity:85/234 - (36%) Gaps:65/234 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGL----SFNDGGYWCGGSIIDHTWVLTAAHCTN 85
            |.|:|...         :.||......:|:.|||    :..|..:.||||::....|:|||||..
  Fly   362 ATPIKQFS---------SGGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVY 417

  Fly    86 SANHVLIY-------FGASF-RHEAQYTHWVSRSD--MIQ-HPDWNDFLNN---DIALIRIPH-- 134
            .....|.|       ..|.| |:..:.|....|.|  :|: .|.:.....|   |:||:.:..  
  Fly   418 DEGTRLPYSYDTFRVIAAKFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENYYQDLALLTLDEPF 482

  Fly   135 ----------VDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQII-- 187
                      |.|.|...|..:.  :|....::||                 |..|..::|.:  
  Fly   483 ELSHVIRPICVTFASFAEKESVT--DDVQGKFAGW-----------------NIENKHELQFVPA 528

  Fly   188 ---DNNDCRNYYGSNYITDNTICINTDGGKSSCSGDSGG 223
               .|:.||.  ....|..:..||.|.|...:|.|||||
  Fly   529 VSKSNSVCRR--NLRDIQADKFCIFTQGKSLACQGDSGG 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 55/219 (25%)
Tryp_SPc 41..266 CDD:238113 55/218 (25%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 55/216 (25%)
Tryp_SPc 371..591 CDD:304450 55/216 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436758
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.