DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG31326

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:300 Identity:69/300 - (23%)
Similarity:126/300 - (42%) Gaps:78/300 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PSESARAVPVKDMPRAGKIEGRITNGYPA-----------YEGK------IPYIVGL----SFND 62
            |.::.|: ||..:|:    :...:||.|.           ::||      :|::|.:    ..|.
  Fly   240 PQQAVRS-PVDLVPQ----QNPSSNGIPCGRERASTTPLIFQGKSLQRGQLPWLVAIFERRESNG 299

  Fly    63 GGYWCGGSIIDHTWVLTAAHCTNS---------------ANHVLIYFGASFRHEAQYTHWVSRSD 112
            ..:.|||::|..:.||:||||..:               .|.:.|:....||..:|         
  Fly   300 PAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLGRNTLAIHSDGEFRGVSQ--------- 355

  Fly   113 MIQHPD--WNDFLNNDIALIR----IPHVDF------WSLVNKVELPSYNDRYNSYSGWWAVASG 165
            :|.|.:  :..|...|:||:|    :.:.|:      ||..|:::||         .|..:..:|
  Fly   356 LIIHENFQFKQFTEADLALVRLDEPVRYTDYIVPICLWSTSNRMDLP---------QGLKSYVAG 411

  Fly   166 WGLTDNNSGMSNYLNCVDVQIIDNNDCRNYYGSNYITDNTICINTDGGKSSCSGDSGGPLVLHDN 230
            ||..:..:|.:......|:.|:...:|........:..:::|....|. ..|:.|.||||:|.:.
  Fly   412 WGPDETGTGNTEVSKVTDLNIVSEANCALELPHVLVQPSSLCAKKTGA-GPCASDGGGPLMLREQ 475

  Fly   231 NRIV--GIVSFG----SGEGCTAGRPAGFTRVTGYLDWIR 264
            :..|  |::|.|    ....|...:|:.||.|..:::|:|
  Fly   476 DVWVLRGVISGGVINEKENTCELSKPSVFTDVAKHIEWVR 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 62/276 (22%)
Tryp_SPc 41..266 CDD:238113 63/277 (23%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 60/257 (23%)
Tryp_SPc 277..514 CDD:214473 59/255 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471173
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.