DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG8870

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:285 Identity:68/285 - (23%)
Similarity:111/285 - (38%) Gaps:82/285 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGYW-------CGGSIIDHTWVLTAAHC------ 83
            |..|||        ||. .:.|::..|.:.:....       ||||:|::.:|||||||      
  Fly    84 PTKGKI--------PAL-NEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFM 139

  Fly    84 --------------TNSANHVLIYFGASFRHEAQYTHWVSRSDMIQHPDWN--DFLNNDIALIRI 132
                          ..|.|..........::...|.. :....:|.|..:|  ..|.|||||:|:
  Fly   140 DYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYME-IEVDQIITHEQFNRGRRLINDIALVRL 203

  Fly   133 PH-VDFWSLVNKVELP------SYNDRYNSYSGWWAVASGWGLTDNNSGMSNYL--------NCV 182
            .. |.:...:..:.||      ::..::.        ||||  .|...|:::.:        ...
  Fly   204 KFPVRYTRAIQPICLPRAQKLAAHKRKFQ--------ASGW--PDMGQGIASEVLLRSFIAERHP 258

  Fly   183 DVQIIDNNDCRNYYGSNYITDNTICINTDGGKSSCSGDSGGPL---VLHDNNRI---VGIVSFGS 241
            ||       |::.|..|  ..:.||.....|..:..|||||||   |:.....:   .||:|:|.
  Fly   259 DV-------CKSNYDFN--LGSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQ 314

  Fly   242 GEGCT--AGRPAGFTRVTGYLDWIR 264
             :.|.  ..:||.:|:.:.:.:||:
  Fly   315 -KPCVLKTCKPAFYTKTSYFFEWIK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 62/274 (23%)
Tryp_SPc 41..266 CDD:238113 64/276 (23%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 62/267 (23%)
Tryp_SPc 93..337 CDD:214473 60/264 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435662
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.