DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG13318

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:336 Identity:88/336 - (26%)
Similarity:132/336 - (39%) Gaps:99/336 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AVASAG------VVPSESARAVPVKDMPRAGKIEGRITN--GYP--------------------- 46
            ::.|.|      |.|...|..:|......:|:|:.||.|  |||                     
  Fly    82 SIVSPGTSYCQCVPPGSCANPLPTAPSDGSGQIDIRIVNNGGYPTVPTTSSTLTCSYGLVACCQA 146

  Fly    47 -AYE---------------------GKIPYIVGLSFNDGGYWCGGSIIDHTWVLTAAHCTNSANH 89
             :|:                     |..|:...|......|..||::|....||||||  ...|.
  Fly   147 GSYQCGRRFPPPPGSTTAAPGQASFGAYPWQAALLTTADVYLGGGALITAQHVLTAAH--KVYNL 209

  Fly    90 VLIYFGASFRHEAQYTHW-------------VSRSDMIQHPDWN-DFLNNDIALIRIP---HVDF 137
            .|.||      :.:...|             |..|::..:|.:| :.|.||:|::::.   .:..
  Fly   210 GLTYF------KVRLGEWDAASTSEPIPAQDVYISNVYVNPSFNPNNLQNDVAILKLSTPVSLTS 268

  Fly   138 WSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGMSNYLNC----VDVQIIDNNDCR----- 193
            .|.|..|.||:     .|:.|.....:|||  .|:.|.:.....    |||.:|.|.:|:     
  Fly   269 KSTVGTVCLPT-----TSFVGQRCWVAGWG--KNDFGATGAYQAIERQVDVPLIPNANCQAALQA 326

  Fly   194 NYYGSNYITDNT--ICINTDGGKSSCSGDSGGPLVLHDNN--RIVGIVSFGSGEGCT-AGRPAGF 253
            ...||:::...|  ||...:.||.:|:||.|.|||...|.  .:||:|::|.  ||. ||.|..:
  Fly   327 TRLGSSFVLSPTSFICAGGEAGKDACTGDGGSPLVCTSNGVWYVVGLVAWGI--GCAQAGVPGVY 389

  Fly   254 TRVTGYLDWIR 264
            ..|..||.||:
  Fly   390 VNVGTYLPWIQ 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 78/298 (26%)
Tryp_SPc 41..266 CDD:238113 79/300 (26%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 73/249 (29%)
Tryp_SPc 169..399 CDD:214473 71/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435419
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.