DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and MP1

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:273 Identity:80/273 - (29%)
Similarity:127/273 - (46%) Gaps:41/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PRAGKIEG-RITNGYPAYEGKIPYIVGLSF----NDGGYWCGGSIIDHTWVLTAAHCT------- 84
            |..|:..| |:..|....:.:.|::..:.:    |..|:.||||:|:|.:|||||||.       
  Fly   128 PNCGENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDW 192

  Fly    85 ----------NSANHVLIYFGASFRHEAQ--YTHWVSRSDMIQHPDW----NDFLNNDIALIRI- 132
                      :::.:.....|.:.|.:..  |..: ...:.|.||.:    .|.| |||||:|: 
  Fly   193 ELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDY-PVEERIPHPQYPGNSRDQL-NDIALLRLR 255

  Fly   133 PHVDFWSLVNKVELPSYNDRYNS-YSGWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDCRNYY 196
            ..|.:...:..|.||:...::|: :.|...|.:|||.|:.|. .||.....::..:..::|...|
  Fly   256 DEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNF-TSNIKLKAELDTVPTSECNQRY 319

  Fly   197 GS--NYITDNTICINTDGGKSSCSGDSGGPLVLHD------NNRIVGIVSFGSGEGCTAGRPAGF 253
            .:  ..:|...:|.....|..||.|||||||:|.|      |..|.|:||:|.......|.|..:
  Fly   320 ATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVY 384

  Fly   254 TRVTGYLDWIRDH 266
            |||..||:||.::
  Fly   385 TRVEAYLNWIENN 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 75/259 (29%)
Tryp_SPc 41..266 CDD:238113 76/261 (29%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 75/259 (29%)
Tryp_SPc 138..397 CDD:238113 76/261 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435665
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.