DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and ctrb1

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_002944677.2 Gene:ctrb1 / 394984 XenbaseID:XB-GENE-977509 Length:263 Species:Xenopus tropicalis


Alignment Length:271 Identity:92/271 - (33%)
Similarity:137/271 - (50%) Gaps:23/271 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLACLAVASAGVVPSESARAVPVKDMPRAGKIEG--RITNGYPAYEGKIPYIVGLSFNDG 63
            |.....::|||:|:. |......:..||        :.|  ||.||..|..|..|:.|.|..:..
 Frog     1 MAFLWLVSCLALATT-VYGCGQPQIAPV--------VTGYARIVNGEEAVPGSWPWQVSLQDSTS 56

  Fly    64 GYWCGGSIIDHTWVLTAAHCTNSANHVLIYFGASFRHEAQYTHWVSRSDMIQHPDWN-DFLNNDI 127
            .::||||:|::.||:|||||..|....::..........:....::.:.:..||.|| :.:||||
 Frog    57 WHFCGGSLINNEWVVTAAHCGVSTRDKVVLGEHDRGSNVEKIQSLAVAKVFTHPQWNSNTINNDI 121

  Fly   128 ALIRI--PHVDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGMS-NYLNCVDVQIIDN 189
            :||::  |.| ..:.|..|.|.:..:.|.  .|...|.||||.|..|:..: |.|....:.::.|
 Frog   122 SLIKLATPAV-IGATVAPVCLANIGEDYE--GGRICVTSGWGKTRYNAFTTPNQLQQTALPLLTN 183

  Fly   190 NDCRNYYGSNYITDNTICINTDGGKSSCSGDSGGPLVLHDNN--RIVGIVSFGSGEGCTAGRPAG 252
            :.|::|:|:| ||...||... .|.|||.||||||||...|:  .:|||||:||.. |:...||.
 Frog   184 DQCKSYWGNN-ITGTMICAGA-AGSSSCMGDSGGPLVCQANDAWTLVGIVSWGSSM-CSTSTPAV 245

  Fly   253 FTRVTGYLDWI 263
            :.||.....|:
 Frog   246 YARVAVLRSWV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 82/228 (36%)
Tryp_SPc 41..266 CDD:238113 82/229 (36%)
ctrb1XP_002944677.2 Tryp_SPc 33..256 CDD:214473 82/228 (36%)
Tryp_SPc 34..259 CDD:238113 82/229 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.