DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG3088

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:271 Identity:116/271 - (42%)
Similarity:162/271 - (59%) Gaps:19/271 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLACLAVASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGY 65
            |||.|....|.:.:||     ||:    ||......|   ||||.|||||:.||:||::|.....
  Fly     1 MKLLVVFLGLTLVAAG-----SAK----KDSEDPDHI---ITNGSPAYEGQAPYVVGMAFGQSNI 53

  Fly    66 WCGGSIIDHTWVLTAAHCTNSANHVLIYFGASFRHEAQYTHWVSRSDMIQHPDWNDFLNNDIALI 130
            ||.|:||..||:||:|.|...::.|.|||||:...:||:|..|..|:.:..       |..:||:
  Fly    54 WCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVGTSEYVTG-------NQHLALV 111

  Fly   131 RIPHVDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDCRNY 195
            |:|.|.|.:.||:|.|||..:|...|..|||...|||:|..::|:::.|.|||:||:.||:|..:
  Fly   112 RVPRVGFSNRVNRVALPSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNECIAF 176

  Fly   196 YGSNYITDNTICINTDGGKSSCSGDSGGPLVLHDNNRIVGIVSFGSGEGCTAGRPAGFTRVTGYL 260
            |||..::|..:|..|..|:|:|.||:|.||:...::.:|||.:|.:..|||.|.||||.|:|..|
  Fly   177 YGSTTVSDQILCTRTPSGRSTCFGDAGSPLITKQDSTVVGISAFVASNGCTLGLPAGFARITSAL 241

  Fly   261 DWIRDHTGIVY 271
            |||...|||.|
  Fly   242 DWIHQRTGIAY 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 98/222 (44%)
Tryp_SPc 41..266 CDD:238113 100/224 (45%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 100/223 (45%)
Tryp_SPc 29..244 CDD:214473 98/221 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470806
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.