DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG33465

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:237 Identity:55/237 - (23%)
Similarity:98/237 - (41%) Gaps:47/237 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PYIVGLSFNDGGYWCGGSIIDHTWVLTAAHCTNSANHVLIYFG--------ASFRHEAQYTHWVS 109
            |::..: :.:..:.|.|:::...:|||||.|.:..:.:.:.||        :.|.:..||...|:
  Fly    46 PWMASI-YKNNQFICDGTLVHKLFVLTAASCISKDSQLYVLFGMYNQYRDASQFFNNEQYGVAVA 109

  Fly   110 RSDMIQHPDW--NDFLNNDIALIRI-------PHV-DFWSLVNKVELPSYNDRYNSYSGWWAVAS 164
                :||.::  |:.: |||.|:|:       .|: ....:::.|...:..:|:..:        
  Fly   110 ----LQHSNFRPNNGV-NDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERFEGF-------- 161

  Fly   165 GWGLTDNNSGMSNYLNCVDVQIIDNNDCRNYYGSNYITDNTICI-NTDGGKSSCSGDSGGPLVLH 228
            || ........|.....|.:......:|........|.:...|. |.|  :|.|..:||.||...
  Fly   162 GW-QQQGTEASSQVRQTVYLSQKKPFECHRNGQLLPINEGQFCAGNRD--RSFCRSNSGSPLTAD 223

  Fly   229 DNNRI------VGIVSFGSGEGCTAGRPAG-FTRVTGYLDWI 263
            ....:      ||:||:|| |.|:   |.. :|.|..:.|||
  Fly   224 FTYGVKNITVQVGLVSYGS-ELCS---PTSVYTDVVAFKDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 53/235 (23%)
Tryp_SPc 41..266 CDD:238113 55/237 (23%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 55/237 (23%)
Tryp_SPc 46..261 CDD:214473 53/235 (23%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435683
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.