DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and sphinx2

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:286 Identity:75/286 - (26%)
Similarity:126/286 - (44%) Gaps:52/286 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLACLAVASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGL------- 58
            |||.|.|..|::..:               :....|:..|||.||.|....|.|:||:       
  Fly     1 MKLVVALLVLSLTFS---------------VCEKNKLSPRITGGYRAKPYTIIYLVGIVYAKSPL 50

  Fly    59 -SFNDGGYWCGGSIIDHTWVLTAAHCTNSANHVLI--YFGASFRHEAQYTHW------VSRSDMI 114
             |...|    .|:||.:.|:||       ...|||  |..|.|..:..:  |      :.|.:..
  Fly    51 SSLKFG----AGTIISNQWILT-------VKEVLIFKYIEAHFGSKRAF--WGYDILRIYRENFY 102

  Fly   115 QHPDWNDFLNNDIALIRIPHVDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGMSNYL 179
            .|.|    ....|||::.|:..|...:::|.:|:|..|:..|.|...:..|||.......:..::
  Fly   103 FHYD----KTRIIALVKCPYQKFDRRMSRVRVPAYGARFERYVGNMTMVCGWGTDKRKVRLPTWM 163

  Fly   180 NCVDVQIIDNNDCRNYYGSNYITDNTICINTDGGKSSCSGDSGGPLV-LHDNNRIVGIVSFGSGE 243
            .||:|::::|.:|..|:  ..:....:|.:.:|.|..|.||.||.:| :..|...:||: :....
  Fly   164 RCVEVEVMNNTECAKYH--TPLKWYEMCTSGEGFKGVCEGDMGGAVVTMGPNPTFIGII-WLMPT 225

  Fly   244 GCTAGRPAGFTRVTGYLDWIRDHTGI 269
            .|:.|.|:...||:.::.||:..:|:
  Fly   226 NCSIGYPSVHIRVSDHIKWIKHVSGV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 65/239 (27%)
Tryp_SPc 41..266 CDD:238113 66/241 (27%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 65/239 (27%)
Tryp_SPc 26..248 CDD:304450 66/241 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471025
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.