DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG13527

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:243 Identity:68/243 - (27%)
Similarity:106/243 - (43%) Gaps:48/243 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 YIVGLS-------FNDGGYWCGGSIIDHTWVLTAAHCT-------NSANHVLIYFGASFRHEAQY 104
            |:|.:.       |.|..| |||.::.:.||:|||||.       ..|..:|:..|:.  |..:|
  Fly    43 YVVSIRSRTPNKYFGDNHY-CGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSP--HRLRY 104

  Fly   105 THWVSRSDMIQ--HPDWNDFLNN--DIALIRI--------PHVDFWSLVNKVELPSYNDRYNSYS 157
            |...|....:.  :...|..::|  ::||:::        |.:.|..|..  |.|....|:    
  Fly   105 TPGKSVCSPVSSLYVPKNFTMHNTFNMALMKLQEKMPSNDPRIGFLHLPK--EAPKIGIRH---- 163

  Fly   158 GWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDCRNYYGSNYITDNTICINTDG---GKSSCSG 219
                ...|||.......::.::..|||.::||..|:.|:  .:..|..:|...:.   ....|||
  Fly   164 ----TVLGWGRMYFGGPLAVHIYQVDVVLMDNAVCKTYF--RHYGDGMMCAGNNNWTIDAEPCSG 222

  Fly   220 DSGGPLVLHDNNRIVGIVSFGSGEGCTAGRPAGFTRVTGYLDWIRDHT 267
            |.|.||:  ....:||||::..|.||| ..|:.:|.|...|.||| ||
  Fly   223 DIGSPLL--SGKVVVGIVAYPIGCGCT-NIPSVYTDVFSGLRWIR-HT 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 63/237 (27%)
Tryp_SPc 41..266 CDD:238113 66/240 (28%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 66/241 (27%)
Tryp_SPc 43..263 CDD:214473 63/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.