DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG30283

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:289 Identity:84/289 - (29%)
Similarity:134/289 - (46%) Gaps:57/289 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLFVFLACLAVASAGVVPSESAR-------AVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLS 59
            |:||.:..||.:|..|:.|||..       .||:...        :|..|:.|.....|: :.:.
  Fly     5 KIFVVVVLLAASSVVVLGSESGSFLEHPCGTVPISQF--------KILGGHNAPVASAPW-MAMV 60

  Fly    60 FNDGGYWCGGSIIDHTWVLTAAHCTNSANHVL-IYFGASFRH-EAQYTHWVSRSDMIQHPDWNDF 122
            ..:||:.|||::|.:.:|||:|||.  ||..| :..|...|. |||.   .:...|..|.|:. |
  Fly    61 MGEGGFHCGGTLITNRFVLTSAHCI--ANGELKVRLGVLEREAEAQK---FAVDAMFVHTDYY-F 119

  Fly   123 LNNDIALIRIPHVDFWS------------LVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGM 175
            ..:|:||:|:.....:|            ||..::  .:..::.:|        |||.|::.|. 
  Fly   120 DQHDLALLRLAKRVHYSDNISPICLLLDPLVKNID--EHIVKFRTY--------GWGKTESRSS- 173

  Fly   176 SNYLNCVDVQIIDNNDCRNYYGSNYITDNTICINTDGGKSSCSGDSGGPL---VLHDNNRIV--- 234
            |..|....:..:..::|...|....|..|.||..: ...::|:|||||||   |.:|:.::|   
  Fly   174 SRMLQKTSLFNLHRSECAKQYPHQQINRNHICAES-ANANTCNGDSGGPLTAIVTYDHVQMVFQF 237

  Fly   235 GIVSFGSGEGCTAGRPAGFTRVTGYLDWI 263
            |:.|||..: |:  :...||.|..:||||
  Fly   238 GVTSFGHAD-CS--KATVFTNVMTHLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 70/242 (29%)
Tryp_SPc 41..266 CDD:238113 72/243 (30%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 70/242 (29%)
Tryp_SPc 43..266 CDD:238113 72/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.